<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1422 1422-30331 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54LV, V82VA, I84V L24I, K43T L10I, T12P, K14KR, I15V, K20R, R57K, D60E, L63P, I64V, P79PS  
>1422-30331| codons 4-99
TLWQRPIVPIRVGGQLREALIDTGADDTVLEEMNLPGRWTPKIIGGIGGFVKVKQYEQIP
VEICGHKAIGTVLVGSTPANVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74V, M184V, T215F K219Q Y181C A98G K43E, T69N, R83K, K122P, I135T, I142V, I167IV, K173Q, I178L, G196E, I202V, D218E, V245E  
>1422-30331| codons 38-247
CTELEEEGKISKIGPENPYNTPVFAIKKKNSNRWRKVVDFRELNKKTQDFWEVQLGIPHP
GGLKKKKSVTVLDVGDAYFSVPLDPDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKVLEPFRQQNPDLVICQYVDDLYVGSDLEIEQHRTKVEELRQHLLRWGFFTP
EQKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006