<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1429 1429-30317 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219E Y188L   T69TN, V90VI, K122E, D123N, S162A, Q174K, I178F, V179I, G196E, T200A, Q207E  
>1429-30317| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSNRWRKLVDFRELNKRTQDFWEIQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQASMTKILEPFRKKNPDFIIYQYVDDLLVGSDLEIEQHRAKIEELREHLLRWGFFTP
DEKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    M36MI, N37S, R57RK, I62V, L63P  
>1429-30317| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVLEEISLPGRWKPKMIGGIGGFIKVKQYDQVP
IEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006