<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1430 1430-30317 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M G73S L10I, I13V, Q18H, K20I, I62V, L63P, C67F, A71V, I72K, P79A  
>1430-30317| codons 4-99
TLWQRPIVTVKIGGHLIEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFVKVRQYDQVP
IEIFGHKVKSTVLVGATPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, T215Y K219N V106A, G190A F227L T39TA, E44D, V118I, K122E, I202V, E203K, H208Y, L210S, K223E, D237DN  
>1430-30317| codons 38-247
CAELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSATVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVASDLEIGQHRTKVKELRQYLSRWGFYTP
DNKHQEEPPLLWMGYELHPNKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006