<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1431 1431-30317 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46IL, I54L, I84V, L90M L33F, G73S L10I, I13V, N37S, R41K, I62V, L63P, C67CFLW, G68E, A71V, I72M, V77I, I93L  
>1431-30317| codons 4-99
TLWQRPIVTVKIGGQLKEALLDTGADDTVFEEMSLPGKWKPKLIGGIGGFLKVRQYDQVP
IEIWEHKVMSTVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, M184V, T215Y K219E   A98G, V108I D121Y, K122E, I135V, S162C, K173R, D177E, Q207E, H208Y, R211K, L228LH, P243PS  
>1431-30317| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHP
GGLKKKKSVTILDVGDAYFSVPLYEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRRQNPEIVIYQYVDDLYVGSDLEIGQHRTKIEELREYLLKWGFYTP
DEKHQKEPPFHWMGYELHPDKWTVQSIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006