<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1413 1413-30821 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K65KR, L74LV, M184MIV, L210LW, T215Y K70KN, F116FY K101P, K103N, G190GA   S68G, V90I, K166KR, I178LM, T200A, H208HY, R211K  
>1413-30821| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKRKDGTNWRKVVDFRELNKRTQDFWEIQLGIPHP
AGLPKNKSVTVLDVGDAYYSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPDMVIYQYVDDLYVASDLEIGQHRAKIEELRQYLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV, I84V, L90M L10FI, V11I, L33I, G73GS, N88ND I13V, L19V, E35D, M36I, I62IV, L63P, A71AV  
>1413-30821| codons 4-99
TLWQRPIITVKIGGQVKEALLDTGADDTVIEDINLPGRWKPKMIGGIGGFVKVRQYDQVP
IEICGHKVISTVLVGPTPVNVIGRDLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006