<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1411 1411-30821 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I L10LI, E35D, M36I, I62V, L63P, I64IV, A71V, I72T  
>1411-30821| codons 4-99
TLWQRPIVTIKIGGQLKEALIDTGADDTVLEDINLPGRWKPKLIGGIGGFVKVRQYDQVP
VEICGHKVTGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, V75T, T215F A62V, D67G, K219Q V106A, G190A F227L S68G, K122E, I135T, E138G, S162C, K173Q, I202V, F214L, H221Y, I244IV  
>1411-30821| codons 38-247
CTELEKEGKISKIGPENPYNTPVFVIKKKGGTKWRKITDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSATVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNGTPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRQQNPDIVIYQYMDDLYVASDLEIGQHRTKVEELRQHLLRWGLFTP
DQKYQKEPPLLWMGYELHPDKWTVQPVVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006