<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1886 1886-30716 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, V82A, L90M L10F, F53L, L89V I13V, K20IV, M36I, L63P, H69KN, A71IV  
>1886-30716| codons 4-99
TLWQRPFVTVKIGGQLVEALLDTGADDTILEEINLPGRWKPKIVGGIGGLIKVRQYDQIP
IEICGNKVIGTVLVGPTPANIIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y K219R   A98G K43Q, E44D, T107TS, V118I, K122E, D123N, T200A, E203K, Q207DE, H208Y, R211K, K223E, L228H, V245E N54I
>1886-30716| codons 38-247
CTELEQDGKISKIGPEIPYNTPVFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLKKKKSVSVLDVGDAYFSIPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKIKELREYLWKWGFYTP
DRKHQEEPPFHWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006