<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1408 1408-30514 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I50V, I54V, V82A, L90M   L10I, K20R, E35D, M36I, N37HQ, R41K, I62IV, L63P, H69Y, A71V, I72V, V77I, I93L  
>1408-30514| codons 4-99
TLWQRPIVTIKIGGQLREALLDTGADDTVLEDIQLPGKWKPKMIVGVGGFVKVRQYDQVP
IEICGYKVVGTVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, M184V, T215NY   K103KNRS   K43KE, E44ED, V118I, K122E, D177N, G196GE, L210F, R211K  
>1408-30514| codons 38-247
CTELEEDGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKSKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPNIVIYQYVDDLYVGSDLEIEQHRTKIEELRQHLFKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006