<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1405 1405-30501 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54IV, I84V, L90M L10F, K43T L19I, K20R, E35D, M36I, D60E, I62V, L63A  
>1405-30501| codons 4-99
TLWQRPFVTIKIGGQIREALLDTGADDTVLEDINLPGRWTPKIIGGIGGFVKVRQYEQVA
IEICGHKAIGTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74I, L210W, T215Y   K103N, Y181YC   K43E, K122P, I142IT, D177E, I178M, T200A, E203D, R211K, H221HY  
>1405-30501| codons 38-247
CTELEEEGKISKIGPENPYNTPVFAIKKKNSDKWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDPDFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEMVICQYMDDLYVGSDLEIGQHRAKIDELRQHLWKWGFYTP
DKKYQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006