<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1404 1404-30424 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, I84V, L90M G73GS, T74P L10I, R41K, K55R, I62V, L63P, C67CF, A71V, V77I, L89LM, I93L  
>1404-30424| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFVRVRQYDQVP
IEIFGHKVISPVLIGPTPVNVIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, T215Y V75T, K219E K103N A98G, V108I I94L, V118I, I142V, G196E, I202V, E203D, L210S, H221Y, V241I  
>1404-30424| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKITDFRELNKRTQDFWEVQLGLPHP
GGLKKNKSVTILDVGDAYFSIPLDKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRTKVDELRQHLSRWGFYTP
DEKYQKEPPFLWMGYELHPDKWTIQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006