<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1776 1776-30509 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54M, L76V, I84V, L90M F53FL L10Y, I15V, K20IV, E34K, E35D, M36I, N37D, I62V, L63P, C67CF, H69Q, A71V, L89LIM  
>1776-30509| codons 4-99
TLWQRPYVTIKVGGQLVEALLDTGADDTVLKDIDLPGRWKPKIVGGIGGLMKVRQYDQVP
IEIFGQKVIGTVVVGPTPVNVIGRNMMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74I, M184V, T215Y     A98G T39A, D123E, I135L, I202V, H208Y, R211K  
>1776-30509| codons 38-247
CAELEKEGKISKIGPENPYNTPVFAIKKKNSDKWRKIVDFRELNKRTQDFWEVQLGIPHP
GGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKVEELRQYLLKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006