<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1775 1775-30509 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, I84V   L10I, I15V, K20R, M36I, I62V, L63P, L89LM  
>1775-30509| codons 4-99
TLWQRPIVTIKVGGQLREALLDTGADDTVLEEINLPGRWKPKIIGGIGGFVKVRQYDQVP
IEICGHKAIGTVVVGPTPVNVIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70KR, L74LIV, M184V, T215F V75VL, K219Q K103N V108I V60I, K102G, K122E, D123E, I135T, S162A, H208HY, K223T, L228H, V245Q  
>1775-30509| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKNSDRWRKVLDFRELNKRTQDFWEVQLGIPHP
AGLKGNKSVTILDVGDAYFSVPLDEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQASMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQYLLRWGFFTP
DQKHQTEPPFHWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006