<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1126 1126-30417 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54L, V82A, L90M L10F, L33F, F53L I13V, I15V, K20R, M36IL, R41K, I62V, L63P, I66F, A71V, I72L  
>1126-30417| codons 4-99
TLWQRPFVTVKVGGQLREALLDTGADDTIFEELNLPGKWKPKIVGGIGGLLKVRQYDQVP
IEFCGHKVLGTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74I, M184V T215V, K219Q K103N V108I, P225H S48T, K122E, I135M, S162C, T200A, L228V, V245Q  
>1126-30417| codons 39-247
TEMEKEGKITKIGPENPYNTPVFAIKKKDSTKWRKIVDFRELNKRTQDFWEVQLGIPHPA
GLKKNKSVTILDVGDAYFSVPLDEDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPA
IFQCSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFVTPD
QKHQKEHPFVWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006