<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1125 1125-30814 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 20

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215F V75T, K219E Y181I   T39A, S48T, T69N, K122E, I135L, T200A, E203D, K223E, L228H  
>1125-30814| codons 38-247
CAELEKEGKITKIGPENPYNTPVFAIKKKNSNRWRKLTDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIIQYMDDLYVGSDLEIGQHRAKIDELRQHLLRWGFFTP
DEKHQEEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V, I54V, L90M   L10I, K20R, E35D, M36I, N37AE, K55KR, I62V, L63P, A71V, I85V, Q92K  
>1125-30814| codons 4-99
TLWQRPIVTIKIGGQLREALLDTGADDTVLEDIELPGRWKPKIIGGVGGFVRVRQYDQVP
IEICGHKVIGTVLVGPTPVNIVGRNLMTKIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006