<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1124 1124-30326 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M   L10I, I13IV, K55KR, I62V, L63P, A71V, T74S, V77VI  
>1124-30326| codons 4-99
TLWQRPIVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVRVRQYDQVP
IEICGHKVIGSVLIGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V K219Q     T39A, V60I, K64H, E138EA, S162A, Q197K, R211RK, F214L, D218E, L228H, V245K  
>1124-30326| codons 38-247
CAEMEKEGKISKIGPENPYNTPIFAIHKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSP
AIFQASMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGKHRTKIEELRQHLLKWGLTTP
EQKHQKEPPFHWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006