<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1118 1118-30310 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y   K103N, Y181C   K43Q, E44D, V118I, K122E, D123E, I135T, G196E, E203K, Q207DN, H208Y, R211K, K223Q  
>1118-30310| codons 38-247
CTELEQDGKISKIGPENPYNTPVFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYVGSDLEIEQHRTKIKELRNYLWKWGFYTP
DKKHQQEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, I84V, L90M L10F, L33F, K43T, G73S, L89V L19LQ, K20R, E35D, M36I, N37D, L63P, K70T, A71V T74I
>1118-30310| codons 4-99
TLWQRPFVTIKIGGQQREALLDTGADDTIFEDIDLPGRWTPKIVGGIGGFMKVRQYDQIP
IEICGHTVISIVLVGPTPVNVIGRNVMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006