<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1115 1115-30304 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54A, V82A K43T L10I, I62V, L63P, I64V, A71AV, V77I, I93IL  
>1115-30304| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWTPKMIVGIGGFAKVRQYDQVP
VEICGHKVIGTVLIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, L210W, T215Y K219R K103N, Y181C, G190GA V108VI T39A, E44D, V90VI, V118I, I142T, K166R, K173Q, T200TA, R211K, L228R, V245VE  
>1115-30304| codons 38-247
CAELEKDGKISKIGPENPYNTPVFAIKKKDSDKWRKLVDFRELNKRTQDFWEIQLGIPHP
AGLKKNKSVTILDVGDAYFSIPLDKDFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRQQNPDIVICQYMDDLYVASDLEIGQHRAKIEELRQHLWKWGFYTP
DRKHQKEPPFRWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006