<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1402 1402-30702 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, L90M K43T, G73S, L89V L10I, V11L, I13V, L19I, K20R, E35D, M36I, N37H, L63P, A71I, I72E, V77I, V82I, I93L  
>1402-30702| codons 4-99
TLWQRPILTVKIGGQIREALLDTGADDTILEDIHLPGRWTPKIVGGIGGFMKVRQYDQIP
IEICGHKIESTVLIGPTPINIIGRNVMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215F K219E Y181C, G190S   T39A, E44D, V60I, K101Q, V118I, K122E, E203D, H208Y, R211K, D218E, L228H, Q242H  
>1402-30702| codons 38-247
CAELEKDGKISKIGPENPYNTPIFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYVSSDLEIGQHRTKIDELRQYLWKWGFFTP
EEKHQKEPPFHWMGYELHPDKWTVHPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006