<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1401 1401-30626 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, V82A L10FI, L24I, L33F, K43T T12P, K14R, E35D, M36L, K55R, Y59YF, I62IV, L63P, A71T, I72T, V77VI, T91S  
>1401-30626| codons 4-99
TLWQRPIVPIRIGGQLKEALIDTGADDTIFEDLNLPGRWTPKIVGGIGGFIRVRQFDQVP
IEICGHKTTGTVLIGPTPANIIGRNLLSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V, T215Y D67G, K219D     T39A, E44D, S68G, L100LF, D123E, I135L, D177E, I178L, T200A, I202V, E203K, K223E, E224D, L228H, V245I  
>1401-30626| codons 38-247
CAELEKDGKISKIGPENPYNTPVFAIKKKGGTKWRKIVDFRELNKRTQDFWEVQLGIPHP
AGFKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPELVIYQYVDDLYVGSDLEIGQHRAKVKELRQHLLRWGFYTP
DDKHQEDPPFHWMGYELHPDKWTVQPIILP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006