<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1014 1014-30324 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, L90M N88D I13V, K20KR, E35D, M36I, N37S, R57K, I62V, L63P, A71T  
>1014-30324| codons 4-99
TLWQRPLVTVKIGGQLREALLDTGADNTVLEDISLPGRWKPKMIGGIGGFIKVKQYDQVP
IEICGHKTIGTVLVGPTPVNIIGRDLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V D67G, T215I, K219E Y181I   S68G, K122E, I135V, I142L, Y144F, K173Q, I202V, F214L  
>1014-30324| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKGGTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGLRFQYNVLPQGWKGSP
AIFQSSMTKILEPFRQQNPDIVIIQYVDDLYVGSDLEIGQHRTKVEELRQHLLRWGLITP
DEKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006