<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1913 1913-30515 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219Q K103KNRS   T69N, A98S, K122E, I135T, I142V, Q174K, N175Y, G196DE, Q207E, R211K, V245T  
>1913-30515| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKKSKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKKYPDIVIYQYVDDLYVGSDLEIEQHRTKIEELREHLLKWGFFTP
DQKHQKEPPFLWMGYELHPDKWTVQPITLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I54LV, V82A, L90M L10F, L33F, N88D I15V, K20V, E35N, M36I, R41K, I62V, L63P, K70N, A71V, I72V  
>1913-30515| codons 4-99
TLWQRPFVTIKVGGQLVEALLDTGADNTVFENINLPGKWKPKMIGGIGGFVKVRQYDQVP
IEICGHNVVGTVLVGPTPANIIGRDLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006