<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1114 1114-30509 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, K70R, Y115F, Q151M A62V, V75I, F77L, F116Y, K219E Y181I   T39TA, S68G, V118I, K122E, K166R, I202V, R211RK, F214L  
>1114-30509| codons 38-246
CAEMEKEGKISKIGPENPYNTPVFVIKRKDGTRWRKLIDLRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAFYSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQSSMTRILEPFRKQNPDIVIIQYMDDLYVGSDLEIGQHRTKVEELRQHLLKWGLTTP
DEKHQKEPPFLWMGYELHPDKWTVQPIVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L, I84V, L90M L33F, G73T L10I, K20R, E34EV, E35D, M36I, R41K, I62V, L63P, A71I, V77VI, I93L  
>1114-30509| codons 4-99
TLWQRPIVTIKIGGQLREALLDTGADDTVFVDINLPGKWKPKMIGGIGGFLKVRQYDQVP
IEICGHKIITTVLIGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006