<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1612 1612-30716 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74IV, M184V, L210W, T215Y K219R     T39A, K43E, K101Q, V111I, K122E, I135T, T165I, T200E, R211K, V245Q E44H
>1612-30716| codons 38-247
CAELEEHGKISKIGPENPYNTPVFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTVLDIGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMIKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHREKIEELRQHLWKWGFYTP
DRKHQKEPPFLWMGYELHPDKWTVQPIQLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M F53L, G73S L10IV, I13V, I15V, G16A, Q18K, K20I, M36I, N37D, K55R, L63P, A71V, I72IM, T91S, Q92K  
>1612-30716| codons 4-99
TLWQRPVVTVKVAGKLIEALLDTGADDTVLEEIDLPGRWKPKLIGGIGGLVRVRQYDQIP
IEICGHKVMSTVLVGPTPANIIGRNLMSKIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006