<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1611 1611-30626 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V, I54V, L76V, L90M L10F, G73S, L89LV I15IV, K20I, E34Q, E35D, M36I, N37D, I62V, L63P, H69QR, I93M A71FI
>1611-30626| codons 4-99
TLWQRPFVTIKVGGQLIEALLDTGADDTVLQDIDLPGRWKPKIIGGVGGFVKVRQYDQVP
IEICGRKIISTVVVGPTPVNIIGRNVMTQMGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y   Y181C, G190GA V108VI T39A, K43E, K101Q, K122KE, G196E, Q197K, E203D, H208Y, R211K, V245Q  
>1611-30626| codons 38-247
CAELEEEGKISKIGPENPYNTPVFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTILDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYVASDLEIEKHRTKIDELRQYLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006