<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2218 2218-30814 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, K14R, I15V, G16E, P39PS, L63T, V77I, I93L  
>2218-30814| codons 4-99
TLWQRPIVTIRVEGQLKEALLDTGADDTVLEEMNLSGRWKPKMIGGIGGFIKVRQYDQIT
IEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L210W T215D     K64R, D123E, I142V, S162C, K173E, I195IT, T200A, E203K, Q207E, R211K, V245K  
>2218-30814| codons 39-247
TEMEKEGKISKIGPENPYNTPVFAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPA
GLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPA
IFQCSMTKILEPFREQNPDIVIYQYMDDLYVGSDLETGQHRAKIKELREHLWKWGFDTPD
KKHQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006