<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2421 2421-30819 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y   K103KN, Y181C, G190GA   K122E, V189VI, Q207E, H208Y, R211K, L228R, V245K  
>2421-30819| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYMDDLYIASDLEIGQHRTKIEELREYLWKWGFYTP
DKKHQKEPPFRWMGYELHPDKWTVQPIKLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, L33F, G73GAST L24*, K55R, R57K, I62V, L63P, A71T, I72E  
>2421-30819| codons 4-99
TLWQRPFVTIKIGGQLKEAL*DTGADDTVFEEMNLPGRWKPKIIGGIGGFVRVKQYDQVP
IEICGHKTETTVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006