<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2132 2132-30820 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74LI, M184V, T215F K219Q K103NS, G190A   V60I, T69N, K122KE, G196E, T200A, Q207E  
>2132-30820| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKNSNRWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLKKSKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVASDLEIEQHRAKIEELREHLLRWGFFTP
DQKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, I84V, L90M   L10I, I13V, K14R, K20I, E35D, M36I, I62V, L63P, I64IV, A71V  
>2132-30820| codons 4-99
TLWQRPIVTVRIGGQLIEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFVKVRQYDQVP
VEICGHKVIGTVLVGPTPANVIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006