<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2131 2131-30813 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L76V, L90M   E35D, N37D, K55R, R57K, I62V, L63P, A71V, I93L  
>2131-30813| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMDLPGRWKPKIIGGIGGFIRVKQYDQVP
IEICGHKVIGTVVVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, T215Y K219Q K103N, Y181C   T39A, E44K, E53Q, V60I, I135L, I178M, Q207AT, H208Y, R211K, H221Y, L228H, V245Q N57K
>2131-30813| codons 38-247
CAELEKKGKISKIGPQNPYKTPIFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDMVICQYMDDLYVGSDLEIGQHRTKIEELRTYLLKWGFYTP
DQKYQKEPPFHWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006