<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3099 3099-30606 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML, I54L, V82A, I84V, L90M L33F, G73T L10I, K55R, D60E, I62V, L63P, C67F, H69R, K70T, A71V, I72T  
>3099-30606| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKLIGGIGGFLRVRQYEQVP
IEIFGRTVTTTVLVGPTPANVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L210W, T215Y V75M, K219E K103NS, Y181C, G190A   E44D, V60I, K101Q, V118I, K122E, D177E, H208Y, R211K, D218E, L228R  
>3099-30606| codons 38-247
CTELEKDGKISKIGPENPYNTPIFAIKKKNSTRWRKLMDFRELNKRTQDFWEVQLGIPHP
AGLQKSKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIVICQYMDDLYVASDLEIGQHRTKIEELRQYLWKWGFYTP
EEKHQKEPPFRWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006