<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3197 3197-40128 Canada 2004 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 23

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69D, K70R, M184MV, T215F D67G   V179E T39A, V60I, S68SG, K122KE, E138A, T139TM, S162A, K173T, Q174K, N175Y, Y181X, T200A, Q207E, R211K, F214L, H221HY, V245Q  
>3197-40128| codons 38-247
CAEMEKEGKISKIGPENPYNTPIFAIKKKGGDRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNAMPGIRYQYNVLPQGWKGSP
AIFQASMTKILEPFRTKYPDIEIXQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGLFTP
DKKYQKEPPFLWMGYELHPDKWTVQPIQLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L89V L10V, I13A, K14R, K20I, A22V, L33L_L, M36I, R41K, I62V, H69K, G73D, T74S, T91TS  
>3197-40128| codons 4-99
TLWQRPVVTARIGGQLIEVLLDTGADDTVLEEINLPGKWKPKMIGGIGGFVKVRQYDQVL
IEICGKKAIDSVLVGPTPANIIGRNVLSQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006