<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3197 3197-30821 Canada 2003 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69D D67G Y181I V179E T39A, V60I, S68G, K122KE, E138A, S162A, K173T, Q174K, N175Y, T200A, Q207E, R211K, F214L, H221Y, V245Q  
>3197-30821| codons 38-247
CAEMEKEGKISKIGPENPYNTPIFAIKKKGGDKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSP
AIFQASMTKILEPFRTKYPDIEIIQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTP
DKKYQKEPPFLWMGYELHPDKWTVQPIQLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L89V L10V, I13A, K14R, K20I, A22V, M36I, R41K, I62V, H69K, G73D, T74S, T91TS  
>3197-30821| codons 4-99
TLWQRPVVTARIGGQLIEVLLDTGADDTVLEEINLPGKWKPKMIGGIGGFVKVRQYDQVL
IEICGKKAIDSVLVGPTPANIIGRNVLSQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006