<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3048 3048-30429 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54L, V82T, I84V, L90M L33F L10I, I13V, K55R, I62V, L63P, K70E, A71V, Q92R  
>3048-30429| codons 4-99
TLWQRPIVTVKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKIIGGIGGFLRVRQYDQVP
IEICGHEVIGTVLVGPTPTNVIGRNLMTRIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69GS_X, T215Y       K64R, R83K, I178IL, G196K, Q207E L228HY
>3048-30429| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIRKKDSSKWRKLVDFRELNKKTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDLVIYQYMDDLYVGSDLEIKQHRTKIEELREHLLRWGFYTP
DKKHQKEPPFYWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006