<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3111 3111-30515 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69T_QA, L210W, T215Y A62V, D67E Y181C   K43E, S68G, V118I, K122E, E138Q, R211N, E224D, L228H  
>3111-30515| codons 38-247
CTELEEEGKISKIGPENPYNTPVFVIKKKEGTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNQTPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLWNWGFYTP
DKKHQKDPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82S L24I, L33F L10I, I13V, M36I, N37D, R57K, I62V, L63P, I64V, A71V  
>3111-30515| codons 4-99
TLWQRPIVTVKIGGQLKEALIDTGADDTVFEEIDLPGRWKPKIIGGIGGFVKVKQYDQVP
VEICGHKVIGTVVVGPTPSNIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006