<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3069 3069-30417 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M L33F, Q58E L10R, T12P, I13V, E35D, N37S, K55R, R57K, I62V, L63P, H69R, V82VI, T91S, C95F  
>3069-30417| codons 4-99
TLWQRPRVPVKIGGQLKEALLDTGADDTVFEDMSLPGRWKPKIIGGIGGFIRVKEYDQVP
IEICGRKAIGTVLVGPTPINVIGRNLMSQIGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, Q151M, M184V A62V, K70N, V75I, F77L, F116Y K103N   T58N, S68G, T69N, K122E, P170PS, T200K, R211K  
>3069-30417| codons 38-247
CTEMEKEGKISKIGPENPYNNPVFVIKKKDGNNWRKLIDLRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAFYSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILESFRKQNPDIVIYQYVDDLYVGSDLEIGQHRKKIEELRQHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006