<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3203 3203-31229 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 20

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32VI, M46MI, I47IV, I54AV, V82VA K43KT L10I, K20R, E35D, M36I, Q61QR, L63P, A71V  
>3203-31229| codons 4-99
TLWQRPIVTIKIGGQLREALLDTGADDTILEDINLPGRWTPKIVGGIGGFVKVRQYDRIP
IEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74LI, M184I, L210W, T215Y K219E K103N   K64KR, V90VI, K102Q, V118I, K122E, D123E, S162Y, D177G, T200A, H208HY, L228H, Q242QH  
>3203-31229| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIRKKNSTRWRKIVDFRELNKRTQDFWEIQLGIPHP
AGLKQNKSVTVLDVGDAYFSIPLDEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPGIVIYQYIDDLYVGSDLEIGQHRAKIEELRQYLWRWGFYTP
DEKHQKEPPFHWMGYELHPDKWTVHPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006