<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3161 3161-30822 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, T74P T12Q, I13IV, I15IV, L19K, K20I, E34EV, M36MI, R41K, K55R, Q61QH, L63P, A71V, T91S, I93L  
>3161-30822| codons 4-99
TLWQRPFVQVKVGGQKIEALLDTGADDTVLVEINLPGKWKPKIIGGIGGFVRVRQYDHIP
IEICGHKVIGPVLVGPTPVNVIGRNLMSQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y   K103N   K43Q, E44D, V118I, K122E, D123DN, I135T, I142IV, G196E, Q197K, R211K, V245E  
>3161-30822| codons 38-247
CTELEQDGKISKIGPENPYNTPVFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDENFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEKHRTKIEELRQHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006