<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3119 3119-30417 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75M, M184V, L210W, T215Y F77L     T39TA, K43EQ, E44ED, K49KR, K101Q, V118VI, K122E, D123E, I135T, R211K, V245E  
>3119-30417| codons 38-247
CAELEQDGKISRIGPENPYNTPVFAIKKKNSTKWRKLMDLRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTVLDVGDAYFSIPLDEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M F53FL, N88D L10I, I13M, I15V, K20IM, M36I, R41K, K45R, I62V, L63P, A71T, T74TK, I85V  
>3119-30417| codons 4-99
TLWQRPIVTMKVGGQLMEALLDTGADDTVLEEINLPGKWKPRLIGGIGGLVKVRQYDQVP
IEICGHKTIGKVLVGPTPANIVGRDLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006