<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3053 3053-30402 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54A, V82A, L90M   L10I, I13V, K20I, L33L_L, E35D, M36I, N37D, I62V, L63P, A71V, L89I  
>3053-30402| codons 4-99
TLWQRPIVTVKIGGQLIEALLDTGADDTVLEDIDLPGRWKPKIIGGIGGFAKVRQYDQVP
IEICGHKVIGTVLVGPTPANIIGRNIMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219N K101P, K103N   E44D, V60VI, A98S, V106I, V118I, K122E, I135IM, V179I, I202V, H208HY, R211K, L228LH  
>3053-30402| codons 38-247
CTELEKDGKISKIGPENPYNTPIFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLPKNKSITVLDVGDAYFSIPLDEDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIIYQYMDDLYVGSDLEIGQHRTKVEELRQYLWKWGFYTP
DNKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006