<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2310 2310-30811 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184MIV, L210W, T215Y   K103N   K43EQ, V90I, A98S, V118VI, D123E, S162Y, V179VI, L228H  
>2310-30811| codons 38-247
CTELEQEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHP
SGLKKNKSVTVLDVGDAYFSIPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPDIIIYQYVDDLYVGSDLEIGQHRTKIEELRQHLWRWGFYTP
DKKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M V11VI, L33F, K43KT, F53L L10V, M36L, R41K, K55R, D60E, I62V, L63P, I64M, A71V, I93L, C95F T91TCS
>2310-30811| codons 4-99
TLWQRPVITIKIGGQLKEALLDTGADDTVFEELNLPGKWTPKLIGGIGGLVRVRQYEQVP
MEICGHKVIGTVLVGPTPANIIGRNLMSQLGFTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006