<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2191 2191-30814 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82T   L10V, E35D, N37A, L63P, I64V, A71V  
>2191-30814| codons 4-99
TLWQRPVVTIKIGGQLKEALLDTGADDTVLEDMALPGRWKPKMIGGIGGFVKVRQYDQIP
VEICGHKVIGTVLVGPTPTNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67N, T69D, T215F K219Q     V90I, K104N, K122E, I202V, R211K, V245M  
>2191-30814| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKNSDKWRKLVDFRELNKRTQDFWEIQLGIPHP
AGLKKKNSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKVEELRQHLLKWGFFTP
DQKHQKEPPFLWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006