<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1594 CA7449 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 191
2 AZT+DDC 121
3 3TC+AZT+SQV 39
4 3TC+AZT+IDV 21
5 3TC+D4T+RTV 21
6 3TC+D4T+NFV+NVP 17
7 3TC+AZT+RTV+SQV 34
8 DDI+EFV 21

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184MV, T215F V75M, K219Q K103N, Y188L   P4S, K32KQ, T39A, K43E, V60I, T69N, R83K, V90I, I135M, T139S, S162Y, D177E, I178M, G196E, Q197E, T200A, L228H L187M
>CA7449| codons 1-258
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIQALVEICAELEEEGKISKIGPENPYNTPI
FAIKKKNSNRWRKLMDFRELNKKTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSMNNESPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPEMVI
YQYVDDMLVGSDLEIEEHRAKIEELRQHLLRWGFFTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48GV, I54V, V82A, L90M   L10I, N37S, R41K, L63P, A71V, V77VI, I93L  
>CA7450| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMSLPGKWKPKMIVGIGGFVKVRQYD
QIPIEICGHKVIGTVLIGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005