<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2063 2063-30625 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54T, V82A L33F, Q58E L10IV, I13IV, L19T, K20R, M36I, R41K, L63P, A71V, I72V, I93L  
>2063-30625| codons 4-99
TLWQRPVVTVKIGGQTREALLDTGADDTVFEEINLPGKWKPKLIVGIGGFTKVREYDQIP
IEICGHKVVGTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, T215Y   G190A A98G K43E, E44D, V118I, D123E, D177E, V179I, T200A, E203V, Q207E, L210S, R211K, D237E  
>2063-30625| codons 38-247
CTELEEDGKISKIGPENPYNTPVFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLKKKKSVTVLDVGDAYFSIPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIIIYQYVDDLYVASDLEIGQHRAKIVELREHLSKWGFYTP
DKKHQKEPPFLWMGYELHPEKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006