<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1262 1262-30324 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54L, V82C, L90M K43T, L89V L10I, V11L, I15V, L19LQ, K20I, E35D, M36I, N37ND, R41K, L63P, A71V, I85V, Q92K  
>1262-30324| codons 4-99
TLWQRPILTIKVGGQQIEALLDTGADDTILEDIDLPGKWTPKIVGGIGGFLKVRQYDQIP
IEICGHKVIGTVLVGPTPCNIVGRNVMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184MV, L210W, T215Y K70Q Y188L   T39A, K43E, V60I, V118I, I135IV, T139TA, S162SC, V189VI, E203D, H208HY, R211K, H221Y, V245T E40FS, K103M
>1262-30324| codons 38-247
CASLEEEGKISKIGPENPYNTPIFAIKKKNSDQWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKMKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSVNNEAPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIVIYQYVDDLLIGSDLEIGQHRTKIDELRQYLWKWGFYTP
DKKYQKEPPFLWMGYELHPDKWTVQPITLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006