<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2341 2341-30728 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LV, T215Y     V179D T39A, K43KQ, E44ED, K103R, K122E, I142V, I178M, E203D, Q207R, H208Y, R211E, V245L  
>2341-30728| codons 38-247
CAELEQDGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKRKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDMDIYQYMDDLYVGSDLEIGQHRTKIDELRRYLLEWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPILLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, V82VA L33IV Q7H, N37T, P39S, R41K, Y59C, D60E, L63P, I64V  
>2341-30728| codons 4-99
TLWHRPLVTIKIGGQLKEALLDTGADDTVVEEMTLSGKWKPKIIGGIGGFIKVRQCEQIP
VEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006