<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2407 2407-30821 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V, I54V, V82A, L90M L33F, K43T L10I, E34Q, E35D, M36I, K55KR, R57K, D60E, I62V, L63P, A71V, V77I, I93L  
>2407-30821| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVFQDINLPGRWTPKIIGGVGGFVRVKQYEQVP
IEICGHKVIGTVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L210W, T215Y V75VA, K219E K103N, Y181YC   T39A, E40F, K43E, W88C, K102R, V118I, K122E, G196E, T200A, Q207QR, H208Y, R211KQ, L228H  
>2407-30821| codons 38-247
CAFLEEEGKISKIGPENPYNTPVFAIKKKNSTRWRKLADFRELNKRTQDFCEVQLGIPHP
AGLKRNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIEQHRAKIEELRRYLWQWGFYTP
DEKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006