<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2225 2225-30820 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54T, V82A L24I, L33F L10I, F53Y, K55KR, L63P, A71V, V77I  
>2225-30820| codons 4-99
TLWQRPIVTIKIGGQLKEALIDTGADDTVFEEMNLPGRWKPKLIVGIGGYTRVRQYDQIP
IEICGHKVIGTVLIGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, M184V, T215F T69G, K219E Y188L   K43N, D67X, V90I, K122E, I135V, S162AD, D177E, T200R, R211K  
>2225-30820| codons 38-247
CTELENEGKISKIGPENPYNTPVFAIKKKXSGRWRKLVDFRELNKRTQDFWEIQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQDSMTKILEPFRKQNPEIVIYQYVDDLLVGSDLEIGQHRRKIEELRQHLLKWGFFTP
DEKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006