<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1598 1598-30711 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y K219N L100I, K103N   E44D, V60VI, V118I, D177DN, G196GE, E203K, H208Y, R211K, K223Q, L228H, Q242H  
>1598-30711| codons 38-247
CTELEKDGKISKIGPENPYNTPIFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPNIVIYQYMDDLYVGSDLEIEQHRTKIKELRQYLWKWGFYTP
DNKHQQEPPFHWMGYELHPDKWTVHPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I54V, L90M L10F, K43T, F53L V11L, K20V, E35D, M36I, N37K, L63P, A71L  
>1598-30711| codons 4-99
TLWQRPFLTIKIGGQLVEALLDTGADDTILEDIKLPGRWTPKIIGGIGGLVKVRQYDQIP
IEICGHKLIGTVLVGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006