<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2258 2258-30721 U.S. 2003 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L10F I13V, G16E, K20I, E35D, M36I, P39S, R41K, I62V, L63C, I64V K45A, R57KT
>2258-30721| codons 4-99
TLWQRPFVTVKIEGQLIEALLDTGADDTVLEDINLSGKWKPAMIGGIGGFVKVTQYDQVC
VEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69S_VG, L74V, M184V D67E Y181CF, Y188L K101H V60I, D121Y, K122E, T139K, D177E, I178L, V189I, T200AV, Q207E, R211K, H221Y, T240A, V245K  
>2258-30721| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKESSKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLHKKKSVTVLDVGDAYFSVPLYEDFRKYTAFTIPSINNEKPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPELVIFQYVDDLLIGSDLEIGQHRVKIEELREHLLKWGFTTP
DKKYQKEPPFLWMGYELHPDKWAVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006