<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2021 2021-30714 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, M184MV, T215Y F77L, K219KN L100I   K122A, D123E, Q174R, D177E, I178M, T200A, Q207E, R211K, L228LH F116I
>2021-30714| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDLRELNKRTQDFWEVQLGIPHP
AGIKKKKSVTVLDVGDAYISVPLDAEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKRNPEMVIYQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFYTP
DNKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10I, E35D, N37D, K45R, I62IV, L63P, K70R, A71V, V77I, I93L  
>2021-30714| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMDLPGRWKPRMIGGIGGFIKVRQYDQVP
IEICGHRVIGTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006