<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2024 2024-30709 U.S. 2003 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V L33F, N83D L10V, I13V, K14R, E35D, M36IL, N37ND, R41K, R57K, H69Q, L89M  
>2024-30709| codons 4-99
TLWQRPVVTVRIGGQLKEALLDTGADDTVFEDLDLPGKWKPKLIGGIGGFVKVKQYDQIL
IEICGQKAIGTVLVGPTPVDIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V60VI, K122E, D123S, I135T, K173L, Q174K, D177E, V179I, T200A, Q207A, R211S, V245Q  
>2024-30709| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRLKNPEIIIYQYVDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006